(data stored in ACNUC30630 zone)

EMBL: CP000113.PE403

CP000113.PE403       Location/Qualifiers
FT   CDS             complement(478915..479796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0418"
FT                   /product="LysM domain protein"
FT                   /note="identified by similarity to SP:O07532; match to
FT                   protein family HMM PF01476"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABF85982"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF84"
FT                   /protein_id="ABF85982.1"
FT                   /translation="MKCFSTHLPENSLESRGVPGAGLENQEARNSGSQAPRIGARRTCG
FT                   ALAPLQTPTEPPMSSSYRIKSGDTLSHLAQRYNTSVSALMKANPQIKNADLIYAGKSLN
FT                   IPGSKDSFESGSAGRAGGATGGGGSSGGAQDVQGPSSSGPGVRGPKGSPFEIASQHLGK
FT                   NAGSLKLEKNGVGADMEDWVPNNVNCANFVSAVLEQSGQISDSQHDNSVMGLMAKLDRD
FT                   PKFKRIDLKDAKPGDVVSMKTNGGQHVVMFAGWKDGKPTFIGSNNVNSDGSQRVTISSM
FT                   NYPIMAVHQYQG"
     MKCFSTHLPE NSLESRGVPG AGLENQEARN SGSQAPRIGA RRTCGALAPL QTPTEPPMSS        60
     SYRIKSGDTL SHLAQRYNTS VSALMKANPQ IKNADLIYAG KSLNIPGSKD SFESGSAGRA       120
     GGATGGGGSS GGAQDVQGPS SSGPGVRGPK GSPFEIASQH LGKNAGSLKL EKNGVGADME       180
     DWVPNNVNCA NFVSAVLEQS GQISDSQHDN SVMGLMAKLD RDPKFKRIDL KDAKPGDVVS       240
     MKTNGGQHVV MFAGWKDGKP TFIGSNNVNS DGSQRVTISS MNYPIMAVHQ YQG              293
//

If you have problems or comments...

PBIL Back to PBIL home page