(data stored in ACNUC30630 zone)

EMBL: CP000113.PE410

CP000113.PE410       Location/Qualifiers
FT   CDS             complement(486021..486389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0426"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89296"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF77"
FT                   /protein_id="ABF89296.1"
FT                   /translation="MNTPNMRAVEAAASAKAALLEEELEQGQRPPDEVERILFHLSRHT
FT                   RAAAIAQLLAYADGATFRDRLVRSGQPHRRRLQWATGELRPFNRFTATGHYGPLCDSLA
FT                   PGWASWPTTLPACRRTRP"
     MNTPNMRAVE AAASAKAALL EEELEQGQRP PDEVERILFH LSRHTRAAAI AQLLAYADGA        60
     TFRDRLVRSG QPHRRRLQWA TGELRPFNRF TATGHYGPLC DSLAPGWASW PTTLPACRRT       120
     RP                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page