(data stored in ACNUC30630 zone)

EMBL: CP000113.PE411

CP000113.PE411       Location/Qualifiers
FT   CDS             complement(486386..486607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0427"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87552"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF76"
FT                   /protein_id="ABF87552.1"
FT                   /translation="MLRNPPRSGLLFLPVVIGWGEDPTGREALQAQGKSNLVVIREDLA
FT                   NDILRAGCDGMIFQEMDDYGREWGKLRE"
     MLRNPPRSGL LFLPVVIGWG EDPTGREALQ AQGKSNLVVI REDLANDILR AGCDGMIFQE        60
     MDDYGREWGK LRE                                                           73
//

If you have problems or comments...

PBIL Back to PBIL home page