(data stored in ACNUC30630 zone)

EMBL: CP000113.PE416

CP000113.PE416       Location/Qualifiers
FT   CDS             complement(491641..492426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0432"
FT                   /product="metallo-beta-lactamase family protein"
FT                   /note="identified by match to protein family HMM PF00753"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86854"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF71"
FT                   /protein_id="ABF86854.1"
FT                   /translation="MTLFPLRWFCAGALLITLSTACTRSTPAATVERNIPVKAQSQGPD
FT                   EYVLADDVSVRKLAPGVWLHITVVTLEPFGRVSTNGLIIEDGETSLLVDTGWDARQGAL
FT                   LLDWARDTLRRPVRAAVVTHFHEDRLGGVPALAPHGIPVHGLEETARIATSLGLPGPTE
FT                   TFAKTSTVDSLELFFPGAGHAKDNIVVWHRDSGVLFGGCFVKDGASTNLGNVADADVAA
FT                   WPASLSRTRQRFPEARVVVPGHGQPGGPELLGHTEALLR"
     MTLFPLRWFC AGALLITLST ACTRSTPAAT VERNIPVKAQ SQGPDEYVLA DDVSVRKLAP        60
     GVWLHITVVT LEPFGRVSTN GLIIEDGETS LLVDTGWDAR QGALLLDWAR DTLRRPVRAA       120
     VVTHFHEDRL GGVPALAPHG IPVHGLEETA RIATSLGLPG PTETFAKTST VDSLELFFPG       180
     AGHAKDNIVV WHRDSGVLFG GCFVKDGAST NLGNVADADV AAWPASLSRT RQRFPEARVV       240
     VPGHGQPGGP ELLGHTEALL R                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page