(data stored in ACNUC30630 zone)

EMBL: CP000113.PE420

CP000113.PE420       Location/Qualifiers
FT   CDS             497605..497877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0436"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91540"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF67"
FT                   /protein_id="ABF91540.1"
FT                   /translation="MPGAHFGGGPQVGGKEAAMSKKDVLHIPPEAIPTAPDRNADTEDE
FT                   ERSPRGSPPALQPEGGPAGTPGTGGSQRIIEPVKSPQPYPGFSVS"
     MPGAHFGGGP QVGGKEAAMS KKDVLHIPPE AIPTAPDRNA DTEDEERSPR GSPPALQPEG        60
     GPAGTPGTGG SQRIIEPVKS PQPYPGFSVS                                         90
//

If you have problems or comments...

PBIL Back to PBIL home page