(data stored in ACNUC30630 zone)

EMBL: CP000113.PE425

CP000113.PE425       Location/Qualifiers
FT   CDS             502511..505480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0441"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88222"
FT                   /db_xref="GOA:Q1DF62"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF62"
FT                   /protein_id="ABF88222.1"
FT                   /translation="MRGHRAQCALHAPHPPRLARRCRVVRMRFHHRPAATTRGPGPPGR
FT                   AEGGAASPPSCARMREPVSPGNVATVGVRCRRPRPLVCPPGRDSQQRGWGPSNPSHPPG
FT                   RRRVGCHKQAGIRSRGALHEAGDSQPYFPPHGINALTLPLARAQGVRRFGQSTDAGVAS
FT                   MSEKRWSERFEGVMGRLAVRNHRKPFQALLLALVLTVLGAYFARTLTLNADFVGLLPKN
FT                   FPSVQDIEKLRKRFGGQGNVVVVGMGADPEVLKRFADDMAPKLGALSEIRYVSHQRPRS
FT                   FFDEHSLYYVDVDDLETIQERIDARILWEKQQANPLFVSLVEEDPPSVDFADIEQKYTG
FT                   RANQRLSGQGDLYYINPTERMVVLMAKPRGSAADLNYSKKVVGQVEDFLAQQDLSKYGP
FT                   GFKTAVTGTFKKKIDQQRVIVGDLASASTLAMVLLLAYLAFHFRSALSVGLTMAPVMAG
FT                   LGWTYGFVGLAYGQVNLLTGFLAAVLGGLGVEHGIHLLGRYTTLRSEGMNSEEAVDESF
FT                   RHTGFSSLIAALVAALTFLSLAMSEFRAFREFGIIAAVGMLVSIFSYVLLLPALLGLAT
FT                   RFGWSPRVQQEGAAGPLSLLARWLPRSYRGVGIVVGVGVLALVSQAYRISFNYDSRTLE
FT                   DYKQASAVLDQKVNDILGYSQTPVVVLTDSQEMEREVVRQLEARKVARGKESTIDFVGA
FT                   LDDLVPKRQDEKQAILQAISAKLEKLDPERLPEDTRNTLVRALNMAKAKPFTQEALPTS
FT                   VRHQFESLDGSTGGVVLVYAGGVSLSDGEGTRKFAKEVRGLQMPDGSQVSAAGEALILA
FT                   DILDMVSREGPRILAAAVLSVLVAMWLTLGKLRTALICMLPTLLSVVGLVGLMSLLGLQ
FT                   FNYLNIMVLPVLVGTTVDAGVHLVQRLGERGADFVSVYAETGRAIMGGLLTSAIGFVAL
FT                   ILAKHPGLNSIGDLANLGFGINMVIVLLGFPSLLLLVERWRRKHSTSSEEQTEQPAPEA
FT                   "
     MRGHRAQCAL HAPHPPRLAR RCRVVRMRFH HRPAATTRGP GPPGRAEGGA ASPPSCARMR        60
     EPVSPGNVAT VGVRCRRPRP LVCPPGRDSQ QRGWGPSNPS HPPGRRRVGC HKQAGIRSRG       120
     ALHEAGDSQP YFPPHGINAL TLPLARAQGV RRFGQSTDAG VASMSEKRWS ERFEGVMGRL       180
     AVRNHRKPFQ ALLLALVLTV LGAYFARTLT LNADFVGLLP KNFPSVQDIE KLRKRFGGQG       240
     NVVVVGMGAD PEVLKRFADD MAPKLGALSE IRYVSHQRPR SFFDEHSLYY VDVDDLETIQ       300
     ERIDARILWE KQQANPLFVS LVEEDPPSVD FADIEQKYTG RANQRLSGQG DLYYINPTER       360
     MVVLMAKPRG SAADLNYSKK VVGQVEDFLA QQDLSKYGPG FKTAVTGTFK KKIDQQRVIV       420
     GDLASASTLA MVLLLAYLAF HFRSALSVGL TMAPVMAGLG WTYGFVGLAY GQVNLLTGFL       480
     AAVLGGLGVE HGIHLLGRYT TLRSEGMNSE EAVDESFRHT GFSSLIAALV AALTFLSLAM       540
     SEFRAFREFG IIAAVGMLVS IFSYVLLLPA LLGLATRFGW SPRVQQEGAA GPLSLLARWL       600
     PRSYRGVGIV VGVGVLALVS QAYRISFNYD SRTLEDYKQA SAVLDQKVND ILGYSQTPVV       660
     VLTDSQEMER EVVRQLEARK VARGKESTID FVGALDDLVP KRQDEKQAIL QAISAKLEKL       720
     DPERLPEDTR NTLVRALNMA KAKPFTQEAL PTSVRHQFES LDGSTGGVVL VYAGGVSLSD       780
     GEGTRKFAKE VRGLQMPDGS QVSAAGEALI LADILDMVSR EGPRILAAAV LSVLVAMWLT       840
     LGKLRTALIC MLPTLLSVVG LVGLMSLLGL QFNYLNIMVL PVLVGTTVDA GVHLVQRLGE       900
     RGADFVSVYA ETGRAIMGGL LTSAIGFVAL ILAKHPGLNS IGDLANLGFG INMVIVLLGF       960
     PSLLLLVERW RRKHSTSSEE QTEQPAPEA                                         989
//

If you have problems or comments...

PBIL Back to PBIL home page