(data stored in ACNUC30630 zone)

EMBL: CP000113.PE432

CP000113.PE432       Location/Qualifiers
FT   CDS             complement(511494..512075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0448"
FT                   /product="dual specificity phosphatase"
FT                   /note="identified by match to protein family HMM PF00782"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89944"
FT                   /db_xref="GOA:Q1DF55"
FT                   /db_xref="InterPro:IPR000340"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR020422"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF55"
FT                   /protein_id="ABF89944.1"
FT                   /translation="MSFALLREVHHVPGVRGWVRKQVLRSVARCVEWTTKLPGRGLNVS
FT                   QVNDWLYVGGAVPRSRYAELKARGITAVIDVRGERCDDAEALKALGIELLNLPVTDRYP
FT                   PSVEQLMRGVEWALPRLEQGGTLYTHCEHGVGRGPLVGLAVMVARGWEAPTAYRELRQA
FT                   RWQSTLNDRQLNGLADFVAAWQARTSERAA"
     MSFALLREVH HVPGVRGWVR KQVLRSVARC VEWTTKLPGR GLNVSQVNDW LYVGGAVPRS        60
     RYAELKARGI TAVIDVRGER CDDAEALKAL GIELLNLPVT DRYPPSVEQL MRGVEWALPR       120
     LEQGGTLYTH CEHGVGRGPL VGLAVMVARG WEAPTAYREL RQARWQSTLN DRQLNGLADF       180
     VAAWQARTSE RAA                                                          193
//

If you have problems or comments...

PBIL Back to PBIL home page