(data stored in ACNUC30630 zone)

EMBL: CP000113.PE433

CP000113.PE433       Location/Qualifiers
FT   CDS             complement(512072..513133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0449"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89248"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF54"
FT                   /protein_id="ABF89248.1"
FT                   /translation="MTTSSTTTRRLPRTRSWSSAPMRPEGRFQALKGLAVATALVLPSV
FT                   AAAGAVLEPKLSPSDNYGENFTFIGDLDGGTFIFVQLTVTNIGPGSRTGLCRTTVLTPG
FT                   KKAWSAQTKVKARDWRYDAESSTLKMGPCSARSTDGATRVEVPLDGGRVLLEYAAPMTP
FT                   QGQEGTEVEVGKDRYHHEVTLAFSALKATVKRPKGEDVVYTGGGYADHTRSTIAPAKLA
FT                   KRWVRFRALLGGEKLVLLAREGQDGEYGPVYAWEEGAKARSLEHFTLAREGVKERSSWT
FT                   VELFTDGSSAMVLRSTSLMQRSAPVEDLGAVLGGLVRSVVGSPVTYLHRAVLEREGKAP
FT                   VTGLMEVTLEGDL"
     MTTSSTTTRR LPRTRSWSSA PMRPEGRFQA LKGLAVATAL VLPSVAAAGA VLEPKLSPSD        60
     NYGENFTFIG DLDGGTFIFV QLTVTNIGPG SRTGLCRTTV LTPGKKAWSA QTKVKARDWR       120
     YDAESSTLKM GPCSARSTDG ATRVEVPLDG GRVLLEYAAP MTPQGQEGTE VEVGKDRYHH       180
     EVTLAFSALK ATVKRPKGED VVYTGGGYAD HTRSTIAPAK LAKRWVRFRA LLGGEKLVLL       240
     AREGQDGEYG PVYAWEEGAK ARSLEHFTLA REGVKERSSW TVELFTDGSS AMVLRSTSLM       300
     QRSAPVEDLG AVLGGLVRSV VGSPVTYLHR AVLEREGKAP VTGLMEVTLE GDL              353
//

If you have problems or comments...

PBIL Back to PBIL home page