(data stored in ACNUC30630 zone)

EMBL: CP000113.PE438

CP000113.PE438       Location/Qualifiers
FT   CDS             517593..518087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0454"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90856"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF49"
FT                   /protein_id="ABF90856.1"
FT                   /translation="MLKTAWNEWSLKALQLETAVLALEEIDLPEEMHALQEAAEEKLLA
FT                   LARAWKARQPQREPRTWERQTLPDGMPRDAELKDLVEGFKEDGKSWTLLRATSDLKEVV
FT                   ETVVSEGRACMAAGGEYYLGQWDAKESVLEVGRDDDADEPGTGLVLEPTGELQYTPDPE
FT                   L"
     MLKTAWNEWS LKALQLETAV LALEEIDLPE EMHALQEAAE EKLLALARAW KARQPQREPR        60
     TWERQTLPDG MPRDAELKDL VEGFKEDGKS WTLLRATSDL KEVVETVVSE GRACMAAGGE       120
     YYLGQWDAKE SVLEVGRDDD ADEPGTGLVL EPTGELQYTP DPEL                        164
//

If you have problems or comments...

PBIL Back to PBIL home page