(data stored in ACNUC30630 zone)

EMBL: CP000113.PE442

CP000113.PE442       Location/Qualifiers
FT   CDS             521962..522576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0458"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88136"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF45"
FT                   /protein_id="ABF88136.1"
FT                   /translation="MRRPGGKRGWWVVTGVVWLGGIVAGSLAMARYSLTPGESLAAPAR
FT                   WPGDSTVPRVEGRPTLVMLAHPLCPCTRASMGELSLVMAKAQGRLDAFVLFLKPEGTGE
FT                   DWEQGELWRSAAAIPGVTALRDEGGVQAERFGAVTSGQVLFYDAGGALRFSGGITTARG
FT                   HVGDNAGRAAVEALLGDAPAEALAGHAVYGCELEDPRGSVP"
     MRRPGGKRGW WVVTGVVWLG GIVAGSLAMA RYSLTPGESL AAPARWPGDS TVPRVEGRPT        60
     LVMLAHPLCP CTRASMGELS LVMAKAQGRL DAFVLFLKPE GTGEDWEQGE LWRSAAAIPG       120
     VTALRDEGGV QAERFGAVTS GQVLFYDAGG ALRFSGGITT ARGHVGDNAG RAAVEALLGD       180
     APAEALAGHA VYGCELEDPR GSVP                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page