(data stored in ACNUC30630 zone)

EMBL: CP000113.PE45

CP000113.PE45        Location/Qualifiers
FT   CDS             complement(56126..56482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0048"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABF85984"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG92"
FT                   /protein_id="ABF85984.1"
FT                   /translation="MFEANCIEEQPADIVARVLEQQSPCFVTAREGVRGVLVPLDEVYT
FT                   EVLEAHPRVINARMKDLVRPGKDMAMYCVQVSLSDEKDAIRFTDEEGEPVLALIGAMRF
FT                   LRWLEEDGEVDEES"
     MFEANCIEEQ PADIVARVLE QQSPCFVTAR EGVRGVLVPL DEVYTEVLEA HPRVINARMK        60
     DLVRPGKDMA MYCVQVSLSD EKDAIRFTDE EGEPVLALIG AMRFLRWLEE DGEVDEES         118
//

If you have problems or comments...

PBIL Back to PBIL home page