(data stored in ACNUC30630 zone)

EMBL: CP000113.PE455

CP000113.PE455       Location/Qualifiers
FT   CDS             534768..535109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0471"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86041"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF32"
FT                   /protein_id="ABF86041.1"
FT                   /translation="MQGDVGNDSEEVAMRRKQAWKEMWSSLFATVFPTDTLLAALRKME
FT                   RHQVRLLGVVGEGGGLLGLVSEEHILAAWRGDPLAPVSGVMARAGAPGAARAGARRSRL
FT                   QGAQPHGAG"
     MQGDVGNDSE EVAMRRKQAW KEMWSSLFAT VFPTDTLLAA LRKMERHQVR LLGVVGEGGG        60
     LLGLVSEEHI LAAWRGDPLA PVSGVMARAG APGAARAGAR RSRLQGAQPH GAG              113
//

If you have problems or comments...

PBIL Back to PBIL home page