(data stored in ACNUC30630 zone)

EMBL: CP000113.PE461

CP000113.PE461       Location/Qualifiers
FT   CDS             536595..537032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0477"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to GB:AAB85612.1"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90684"
FT                   /db_xref="GOA:Q1DF26"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF26"
FT                   /protein_id="ABF90684.1"
FT                   /translation="MEGRVRTPVGAVCATHPDEAAVATCARCGGFLCGDCTELAGETPY
FT                   CAPCVAVLRREARPSRVIQVALALNVAGLACLPCSLALPLPTLVAGLAGVVLGLRELRR
FT                   IARGEGAERGRTLARVTTGLGWVNLGLASSWLAVVFWGFGP"
     MEGRVRTPVG AVCATHPDEA AVATCARCGG FLCGDCTELA GETPYCAPCV AVLRREARPS        60
     RVIQVALALN VAGLACLPCS LALPLPTLVA GLAGVVLGLR ELRRIARGEG AERGRTLARV       120
     TTGLGWVNLG LASSWLAVVF WGFGP                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page