(data stored in ACNUC30630 zone)

EMBL: CP000113.PE470

CP000113.PE470       Location/Qualifiers
FT   CDS             546168..546998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0486"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89882"
FT                   /db_xref="GOA:Q1DF17"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF17"
FT                   /protein_id="ABF89882.1"
FT                   /translation="MGLGPPSLHTRRAQRAAAYSRINVILYIRTRGWRHSKTMTFSETW
FT                   DLAWSILLSIGSAGGLILGLSNWLGKVWANRILEREKLAIQRELQALQAESAQRLHALK
FT                   ERTDVLLKNLEAEHSRRHRVHNLQFAKEFQLYADTWKALHALKIKTLTLRPVGDVVDVR
FT                   ETEEERRERRYKEFAEAFNAAVSVIAENEPFFPQEVFAKIRELQSLSRREAFSYYYKGR
FT                   QKKGVDMKYWEEAEENQQQIVEQVDAICEAIRTRIGLIEIVEGPQGVAPSVPPL"
     MGLGPPSLHT RRAQRAAAYS RINVILYIRT RGWRHSKTMT FSETWDLAWS ILLSIGSAGG        60
     LILGLSNWLG KVWANRILER EKLAIQRELQ ALQAESAQRL HALKERTDVL LKNLEAEHSR       120
     RHRVHNLQFA KEFQLYADTW KALHALKIKT LTLRPVGDVV DVRETEEERR ERRYKEFAEA       180
     FNAAVSVIAE NEPFFPQEVF AKIRELQSLS RREAFSYYYK GRQKKGVDMK YWEEAEENQQ       240
     QIVEQVDAIC EAIRTRIGLI EIVEGPQGVA PSVPPL                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page