(data stored in ACNUC30630 zone)

EMBL: CP000113.PE477

CP000113.PE477       Location/Qualifiers
FT   CDS             complement(550527..552242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0493"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87620"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF10"
FT                   /protein_id="ABF87620.1"
FT                   /translation="MGIGGIIGGAADAARRAAEAAKRAAEAAAKKAAEAAAKKTAEAAA
FT                   TATKTTEQIASVAKKHTQDVFERHEAPGDSGRDVKQKDRETVGDFFEDLRTKAGDALKD
FT                   TAQKVGEELGKATDVLANGLDQLGQAIQDAPAQNPVQDFAQDLAGGILQGAAGVVRDSA
FT                   KTVGAAKDALNFNTQVEQLKPGESVSVGLNAEVDVYAVGITGKGDLTVSRSAEEGGGYT
FT                   VSASGDVGAGIIGKMGGKGAADASASVFGTAGGTVEYKFDTLEEAQRAAGIIAANAAVS
FT                   GASGQNPLLGLGLNFVLGDPRSELAGLRDNVSAVEFELGAEGNLAGELGMKGLQDVLGA
FT                   GASAGVDINQSTTARIEMEGGKPTSLTLTQSQGISADVGANVGLGVPSQGKGGPSASLP
FT                   TSASAGVEGSLKVELEQSIDLPGNFNLDDFLRDPKSAAQELGKSSEAKVTLTDSRQGSA
FT                   QALGLGGSMGREVNVEISGNLEDIANSGAFTSIANGDVGQAVTQLGGKVDIKATVQDKT
FT                   TVKGDIGVGVHAGVVGAEAGVTTERTTVGEEHELTAAQLVELYLTQRWSAGVAS"
     MGIGGIIGGA ADAARRAAEA AKRAAEAAAK KAAEAAAKKT AEAAATATKT TEQIASVAKK        60
     HTQDVFERHE APGDSGRDVK QKDRETVGDF FEDLRTKAGD ALKDTAQKVG EELGKATDVL       120
     ANGLDQLGQA IQDAPAQNPV QDFAQDLAGG ILQGAAGVVR DSAKTVGAAK DALNFNTQVE       180
     QLKPGESVSV GLNAEVDVYA VGITGKGDLT VSRSAEEGGG YTVSASGDVG AGIIGKMGGK       240
     GAADASASVF GTAGGTVEYK FDTLEEAQRA AGIIAANAAV SGASGQNPLL GLGLNFVLGD       300
     PRSELAGLRD NVSAVEFELG AEGNLAGELG MKGLQDVLGA GASAGVDINQ STTARIEMEG       360
     GKPTSLTLTQ SQGISADVGA NVGLGVPSQG KGGPSASLPT SASAGVEGSL KVELEQSIDL       420
     PGNFNLDDFL RDPKSAAQEL GKSSEAKVTL TDSRQGSAQA LGLGGSMGRE VNVEISGNLE       480
     DIANSGAFTS IANGDVGQAV TQLGGKVDIK ATVQDKTTVK GDIGVGVHAG VVGAEAGVTT       540
     ERTTVGEEHE LTAAQLVELY LTQRWSAGVA S                                      571
//

If you have problems or comments...

PBIL Back to PBIL home page