(data stored in ACNUC30630 zone)

EMBL: CP000113.PE48

CP000113.PE48        Location/Qualifiers
FT   CDS             58046..58831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0051"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86022"
FT                   /db_xref="InterPro:IPR029074"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG89"
FT                   /protein_id="ABF86022.1"
FT                   /translation="MARLISLRADAADSLGERLSRFDPGADRSSILARLDAITLDLHLI
FT                   AVATLLVDGHPQGFFLNLCRMAENGRRVQRLLADRGLPPPPARRNTPLLGALAAGHFSL
FT                   AEAVAASSATQWQQGAEYEDEFLWAAALQHLTRTPSAPLESILAPLEKVGQEPYASRVA
FT                   MARALVSRDAAAFAEAFAAACLDHGIVTEKRARSLATPVTSFAPHRFVWLEGLALLRLA
FT                   ERASIAPEDTSFRYCPPLARVPMTTTYSGDWAVDTAPTR"
     MARLISLRAD AADSLGERLS RFDPGADRSS ILARLDAITL DLHLIAVATL LVDGHPQGFF        60
     LNLCRMAENG RRVQRLLADR GLPPPPARRN TPLLGALAAG HFSLAEAVAA SSATQWQQGA       120
     EYEDEFLWAA ALQHLTRTPS APLESILAPL EKVGQEPYAS RVAMARALVS RDAAAFAEAF       180
     AAACLDHGIV TEKRARSLAT PVTSFAPHRF VWLEGLALLR LAERASIAPE DTSFRYCPPL       240
     ARVPMTTTYS GDWAVDTAPT R                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page