(data stored in ACNUC30630 zone)

EMBL: CP000113.PE481

CP000113.PE481       Location/Qualifiers
FT   CDS             554481..556259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0497"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89332"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF06"
FT                   /protein_id="ABF89332.1"
FT                   /translation="MHLVERVLPHVPYRGDPIPLPEPNAGTAAAPGVDDLLLAPHPRLL
FT                   ASVLLAKARGRCGPACAFERSGGMKTRKRLWIGGAAAGLTVLGFASTLVGGDDAEASTN
FT                   SSQSPSLPPECETEAAPRPGNPPQHPAECHGNPNFLADGTAVMTRGDVASLPTQLKNQL
FT                   TRLACRPHSTLPIQFYSEADSPSQLFQYYLLDTNDFEPNVFTSLIPGVNNTAMLTATGA
FT                   NCDLPTVAAVRLVLEPKEGLPVDPNDPRAFIDIITDISGLFVINNESGWYEGWMIHDLR
FT                   VAEVHEPGQDGSAIYGTITPNDAALLAQMGSGNNVPGNFFTVDGEEPRPPSASDNFPDR
FT                   VTNLVPLQLSMGAYNSLQQSDAHQYWEFNYTTNWIHPLYELPFTGGFPDQSATDPATTY
FT                   QEGKIGRKASIVPGNRIGLNKDPQRTIEFGDNPSLPRDPDRFDAEEDSQREFRQRFIPS
FT                   GVAREVFLNVFQRLDSFQPGVTNLEQRLVAAYKAAITVADTNGDGIIQAAEGDIDTCNA
FT                   KCFPATPSDECTDSDSSCLYLPATTYNRFAVTREINDGYLAPRFAPSQRGWVLSGNRVE
FT                   VSPAVPASAGRDSDDR"
     MHLVERVLPH VPYRGDPIPL PEPNAGTAAA PGVDDLLLAP HPRLLASVLL AKARGRCGPA        60
     CAFERSGGMK TRKRLWIGGA AAGLTVLGFA STLVGGDDAE ASTNSSQSPS LPPECETEAA       120
     PRPGNPPQHP AECHGNPNFL ADGTAVMTRG DVASLPTQLK NQLTRLACRP HSTLPIQFYS       180
     EADSPSQLFQ YYLLDTNDFE PNVFTSLIPG VNNTAMLTAT GANCDLPTVA AVRLVLEPKE       240
     GLPVDPNDPR AFIDIITDIS GLFVINNESG WYEGWMIHDL RVAEVHEPGQ DGSAIYGTIT       300
     PNDAALLAQM GSGNNVPGNF FTVDGEEPRP PSASDNFPDR VTNLVPLQLS MGAYNSLQQS       360
     DAHQYWEFNY TTNWIHPLYE LPFTGGFPDQ SATDPATTYQ EGKIGRKASI VPGNRIGLNK       420
     DPQRTIEFGD NPSLPRDPDR FDAEEDSQRE FRQRFIPSGV AREVFLNVFQ RLDSFQPGVT       480
     NLEQRLVAAY KAAITVADTN GDGIIQAAEG DIDTCNAKCF PATPSDECTD SDSSCLYLPA       540
     TTYNRFAVTR EINDGYLAPR FAPSQRGWVL SGNRVEVSPA VPASAGRDSD DR               592
//

If you have problems or comments...

PBIL Back to PBIL home page