(data stored in ACNUC30630 zone)

EMBL: CP000113.PE483

CP000113.PE483       Location/Qualifiers
FT   CDS             complement(556423..557010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0499"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88316"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF04"
FT                   /protein_id="ABF88316.1"
FT                   /translation="MNRCPPGRAHRRSPRMDPFTSEHLGDDGDAQVRGVGRIIDVHRDP
FT                   VASTKVVMIPMLSGCKTTVTVKLALAPNAPRSQPTAEPLRWQLPCEDVTETKVAASELG
FT                   RHGIRVNVVAPGAIQTPLAESVGLIEVMGHEFLARTPLGKPCGMPSDVAGVVSFLCGED
FT                   AAWITGETLSVDGGNHIRGLHSYWDMLSRAAK"
     MNRCPPGRAH RRSPRMDPFT SEHLGDDGDA QVRGVGRIID VHRDPVASTK VVMIPMLSGC        60
     KTTVTVKLAL APNAPRSQPT AEPLRWQLPC EDVTETKVAA SELGRHGIRV NVVAPGAIQT       120
     PLAESVGLIE VMGHEFLART PLGKPCGMPS DVAGVVSFLC GEDAAWITGE TLSVDGGNHI       180
     RGLHSYWDML SRAAK                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page