(data stored in ACNUC30630 zone)

EMBL: CP000113.PE486

CP000113.PE486       Location/Qualifiers
FT   CDS             560676..561191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0502"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="identified by match to protein family HMM PF01037"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90418"
FT                   /db_xref="GOA:Q1DF01"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF01"
FT                   /protein_id="ABF90418.1"
FT                   /translation="MKLDFKFLLFMELKDELDAIDLQLLNLLQNDASTSNQTLAEQVHV
FT                   SPPTCLRRVRRLHELGLIEKQVALLQPDRLAQLQGHGLTAIVEITLDQQGAEFLQAFET
FT                   RVVADAQVQQCWRVSPGPDFVLVVHAHDMPAYHALAQRLFTHDANVRNVKAFFATHRAK
FT                   FDTRVPLL"
     MKLDFKFLLF MELKDELDAI DLQLLNLLQN DASTSNQTLA EQVHVSPPTC LRRVRRLHEL        60
     GLIEKQVALL QPDRLAQLQG HGLTAIVEIT LDQQGAEFLQ AFETRVVADA QVQQCWRVSP       120
     GPDFVLVVHA HDMPAYHALA QRLFTHDANV RNVKAFFATH RAKFDTRVPL L                171
//

If you have problems or comments...

PBIL Back to PBIL home page