(data stored in ACNUC30630 zone)

EMBL: CP000113.PE492

CP000113.PE492       Location/Qualifiers
FT   CDS             568078..571008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0509"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88572"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEZ5"
FT                   /protein_id="ABF88572.1"
FT                   /translation="MGTCPTTGLAPRRVDAVLQQGHALELEGRGALAHREVARAVGLVL
FT                   DRLTLALGGVGQRDGRREDGRLEAKSRRRTELVDSAVGAKEEAIRAWVDRRRGRGREVG
FT                   VSVQRQLDRVDVDQRGLHARRQRLGELVHAALPRAPVLGDDVDVPGGGVHHQRLRVLRA
FT                   VRIDEREGLGDEPPRGLAVGEIRLGHAVDRERRGAATRREVGAPLPDVTDEDARAARAG
FT                   PGCEVLPVGRRHVGHVERADRARVERVDRDDRGGVLVVHVERVADHAARGQARGLHDFR
FT                   RGHGALEREGARVRVAGHAGGGVGGAQDDHVRGVGLHERGAAGEARLEPRRGERPVGRI
FT                   EEQSVGVTQARVEGLGEAERRLDAGGRAGGVRPDLCAVPDGEATRAAGHHVGHGERRGV
FT                   AVLLACVHVDWLDRIDAAEGLHAPRHVGGRVQFERVARRLGGARDAVEDPGADGPGALL
FT                   RAQERPAGGRRDGRGDVVAHGHPRDERVVGLGPRRLGDRQRSDRQAAVVRAPTQRDPRG
FT                   RRDLGAAKGDDLRDVGLGERRAPVERSLEAGTGEGHEGGVEDEALGRGHQAGVVGLGEA
FT                   HGGLDRRGRTRGAGPRLRAEPDGSPARGRGAQLRRSEGRRAAVALAGVRVDRVGRIDAG
FT                   IRHEVADEVARDGALESVARGLAGGGDADEDPAADAPGAHVGAHQRPTCRRGDLGADLV
FT                   PVRKVRQQHVTGGDARRGREGQAGDRLAARVRGADEGDLPGRRRLEGTQHHRVRDVGVG
FT                   ERGAAGEGGLGTCGPELRGGGAVQHAARRRDEAGVELLGEARRRGVDRGARGASPDLGR
FT                   EPHCEAVRGRRGGDGQREARAVAILLAHVHVDRLERIRARHRDQGGRHGAGEVEGEGVT
FT                   ARLGRAGHAEEEPGLDGRGALLGAQQRPASGWGGDGGDGLAIAQLHHQHISGGRTDGGG
FT                   DGEGGDGQTARAGGSSHGERGDALGRRRILYVVGLRELRRSTGGHQ"
     MGTCPTTGLA PRRVDAVLQQ GHALELEGRG ALAHREVARA VGLVLDRLTL ALGGVGQRDG        60
     RREDGRLEAK SRRRTELVDS AVGAKEEAIR AWVDRRRGRG REVGVSVQRQ LDRVDVDQRG       120
     LHARRQRLGE LVHAALPRAP VLGDDVDVPG GGVHHQRLRV LRAVRIDERE GLGDEPPRGL       180
     AVGEIRLGHA VDRERRGAAT RREVGAPLPD VTDEDARAAR AGPGCEVLPV GRRHVGHVER       240
     ADRARVERVD RDDRGGVLVV HVERVADHAA RGQARGLHDF RRGHGALERE GARVRVAGHA       300
     GGGVGGAQDD HVRGVGLHER GAAGEARLEP RRGERPVGRI EEQSVGVTQA RVEGLGEAER       360
     RLDAGGRAGG VRPDLCAVPD GEATRAAGHH VGHGERRGVA VLLACVHVDW LDRIDAAEGL       420
     HAPRHVGGRV QFERVARRLG GARDAVEDPG ADGPGALLRA QERPAGGRRD GRGDVVAHGH       480
     PRDERVVGLG PRRLGDRQRS DRQAAVVRAP TQRDPRGRRD LGAAKGDDLR DVGLGERRAP       540
     VERSLEAGTG EGHEGGVEDE ALGRGHQAGV VGLGEAHGGL DRRGRTRGAG PRLRAEPDGS       600
     PARGRGAQLR RSEGRRAAVA LAGVRVDRVG RIDAGIRHEV ADEVARDGAL ESVARGLAGG       660
     GDADEDPAAD APGAHVGAHQ RPTCRRGDLG ADLVPVRKVR QQHVTGGDAR RGREGQAGDR       720
     LAARVRGADE GDLPGRRRLE GTQHHRVRDV GVGERGAAGE GGLGTCGPEL RGGGAVQHAA       780
     RRRDEAGVEL LGEARRRGVD RGARGASPDL GREPHCEAVR GRRGGDGQRE ARAVAILLAH       840
     VHVDRLERIR ARHRDQGGRH GAGEVEGEGV TARLGRAGHA EEEPGLDGRG ALLGAQQRPA       900
     SGWGGDGGDG LAIAQLHHQH ISGGRTDGGG DGEGGDGQTA RAGGSSHGER GDALGRRRIL       960
     YVVGLRELRR STGGHQ                                                       976
//

If you have problems or comments...

PBIL Back to PBIL home page