(data stored in ACNUC30630 zone)

EMBL: CP000113.PE5

CP000113.PE5         Location/Qualifiers
FT   CDS             complement(4634..5485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0005"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91414"
FT                   /db_xref="GOA:Q1DGD2"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DGD2"
FT                   /protein_id="ABF91414.1"
FT                   /translation="MSAEVPSGALPRCALHPDALAGATCQRCGSFVCTECTTWVMGRMY
FT                   CPACAVRPEVNYLEAFRLKLWGRRDASAWLVVGVTVVLVGLALVALMAGDVGTTLACLG
FT                   SSGVGVAFFLGMRWARMGLLAVPLLAMLLTAQSLGAPALLFFIPLMVAVNVFRDTRSRL
FT                   FFRLDVPERELRQLWDLRVNNPLARHALSLSVGSLFLPVFAPLLSYFGVWSALTFVFAG
FT                   LSMLALILGLVALRRVDPEARPPIGRRWEALGAVCLALVALALWGVLHRTRMVELLGGA
FT                   VD"
     MSAEVPSGAL PRCALHPDAL AGATCQRCGS FVCTECTTWV MGRMYCPACA VRPEVNYLEA        60
     FRLKLWGRRD ASAWLVVGVT VVLVGLALVA LMAGDVGTTL ACLGSSGVGV AFFLGMRWAR       120
     MGLLAVPLLA MLLTAQSLGA PALLFFIPLM VAVNVFRDTR SRLFFRLDVP ERELRQLWDL       180
     RVNNPLARHA LSLSVGSLFL PVFAPLLSYF GVWSALTFVF AGLSMLALIL GLVALRRVDP       240
     EARPPIGRRW EALGAVCLAL VALALWGVLH RTRMVELLGG AVD                         283
//

If you have problems or comments...

PBIL Back to PBIL home page