(data stored in ACNUC30630 zone)

EMBL: CP000113.PE502

CP000113.PE502       Location/Qualifiers
FT   CDS             580425..581000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0519"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAU92366.1; match to
FT                   protein family HMM PF05685"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91923"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEY5"
FT                   /protein_id="ABF91923.1"
FT                   /translation="MGHETKRPATYEDLVALPEHQVGQIIDGELIAQPRPTSRHARATT
FT                   RLGGELYGPFERGRGGPGGWYFLDEPELHFGADVLVPDLAGWRRDRMPEVPDTPYFTLS
FT                   PDWVCEVLSPSTAAVDRSSKRRIYAREGVGHVWLVDPQARTLEVFRLSGGRWLELGTWS
FT                   DDERVRAEPFEAVELELGVLWLPEANAK"
     MGHETKRPAT YEDLVALPEH QVGQIIDGEL IAQPRPTSRH ARATTRLGGE LYGPFERGRG        60
     GPGGWYFLDE PELHFGADVL VPDLAGWRRD RMPEVPDTPY FTLSPDWVCE VLSPSTAAVD       120
     RSSKRRIYAR EGVGHVWLVD PQARTLEVFR LSGGRWLELG TWSDDERVRA EPFEAVELEL       180
     GVLWLPEANA K                                                            191
//

If you have problems or comments...

PBIL Back to PBIL home page