(data stored in ACNUC30630 zone)

EMBL: CP000113.PE504

CP000113.PE504       Location/Qualifiers
FT   CDS             complement(585669..586121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0521"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:CAE07649.1"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89995"
FT                   /db_xref="GOA:Q1DEY3"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEY3"
FT                   /protein_id="ABF89995.1"
FT                   /translation="MPDVLDVNDPCLGCAIVRGETRPVGGVIARAPGLVLHGVAGPSPV
FT                   PGWVVISSARHVRAWYDLEPDAASELGPFAARVMRAQREVLGAEHAYAFAIGDVLRHFH
FT                   LHLVPRYSQTPQRLWGRAAFDAPASDHLPAQELEAAAQALAAALAG"
     MPDVLDVNDP CLGCAIVRGE TRPVGGVIAR APGLVLHGVA GPSPVPGWVV ISSARHVRAW        60
     YDLEPDAASE LGPFAARVMR AQREVLGAEH AYAFAIGDVL RHFHLHLVPR YSQTPQRLWG       120
     RAAFDAPASD HLPAQELEAA AQALAAALAG                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page