(data stored in ACNUC30630 zone)

EMBL: CP000113.PE509

CP000113.PE509       Location/Qualifiers
FT   CDS             594757..595827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0526"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92486"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEX8"
FT                   /protein_id="ABF92486.1"
FT                   /translation="MMRSGRSKCLRVPRRVAGRAAAADIDSVVGPGRWWVMGAWKQTVA
FT                   ALVSAVSMVGCAGNVMEAEPVALRSGVAELVAPNGRNLNGRNLNGRNLNTPELGQLLVS
FT                   VDLAGARIAEEVLGEVRLEGSVFHGVASSGPVSGQSFLGARFIGNLSSGDTVELRVDGI
FT                   EPGAGADADVWAYLVSYYDAADALWKPACAAADGSALSAIPVAGRWDYRQGVAGGGAKV
FT                   DDAARFTFACEGAAIAKCVRFGYRPWGTTADGLSLADHHQACTRMVRADFCGDGTSHTT
FT                   DGQWVNLHDGVNVQTDTEAWLHEAEWDADGARCFTQTTRAAQAVSCPGQTQLTQCGKWA
FT                   HFQAGTLIMSEVPPAQ"
     MMRSGRSKCL RVPRRVAGRA AAADIDSVVG PGRWWVMGAW KQTVAALVSA VSMVGCAGNV        60
     MEAEPVALRS GVAELVAPNG RNLNGRNLNG RNLNTPELGQ LLVSVDLAGA RIAEEVLGEV       120
     RLEGSVFHGV ASSGPVSGQS FLGARFIGNL SSGDTVELRV DGIEPGAGAD ADVWAYLVSY       180
     YDAADALWKP ACAAADGSAL SAIPVAGRWD YRQGVAGGGA KVDDAARFTF ACEGAAIAKC       240
     VRFGYRPWGT TADGLSLADH HQACTRMVRA DFCGDGTSHT TDGQWVNLHD GVNVQTDTEA       300
     WLHEAEWDAD GARCFTQTTR AAQAVSCPGQ TQLTQCGKWA HFQAGTLIMS EVPPAQ           356
//

If you have problems or comments...

PBIL Back to PBIL home page