(data stored in ACNUC30630 zone)

EMBL: CP000113.PE511

CP000113.PE511       Location/Qualifiers
FT   CDS             597272..600463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0528"
FT                   /product="efflux transporter, AcrB/AcrD/AcrF family, inner
FT                   membrane component"
FT                   /note="identified by match to protein family HMM PF00873"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86313"
FT                   /db_xref="GOA:Q1DEX6"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEX6"
FT                   /protein_id="ABF86313.1"
FT                   /translation="MFISYFAIKRPIITINSMLALVVFGLVSLGLLETDEFPDVQPPVV
FT                   SVTIVYPGASPETVEREILEPIEDAIFAISGVDPKETTSIATDGLASFTVFFDFEKDIQ
FT                   EATQDIRDAISSKRADLPQEMEEPILTRFDPADQPIVSLTLTSEGLDVAALSLVADPTV
FT                   VGELRSVPGVAQAEVVGDVAREMTVQLKPEALQAAGLSVAEVVAALQAQNLAAPVGRIN
FT                   APLTEESIRLKGRLEKVEDFRTMVVASRNGRAIRLEQVADVFVGAEEPRTLALFNGAQA
FT                   VGIDVLKARGYSTTEVADAVRERVHALQQRLPAGVKLEIVRDAGVRVENAVHNVQSALV
FT                   EGALLTVLVVFVFLNSWRSTVITGLALPVSVLASFISVWAFGFTLNTMSLLGLTLAIGI
FT                   LIDDAIVVRENIVRHVEMGKDHYTASREGTSEIGLAVSATTFSIVAVFVPVAFMYGVAG
FT                   QWFKPFALTIACAVLVSLFVSFSLDPMLSAYWPEPPRKQNPGFITRTLNRFNAWFDRQA
FT                   ERYKHVIAWALDHRLVMVLVAVGSLVGALVLQGTVGGAGFVPVSDRAEVELLVETPPGS
FT                   SLEYTRRKVDEVTRTLRAHPEVDYTYATIGVPLALSAPGVDQALVYVRLKPKAERDMSQ
FT                   DALGVQFREEMKRIGGATVSVFTSGFGGAFKQLQYELRGPDQRVLTQLAQQVQKEVEQV
FT                   AGAVDVGLSTRGQKPELEVELNRGLAGQLGVTVGQVAQVLRPAFAGLDVGDWVDPIGET
FT                   RDVMVRLAPGARDNPNDLSQLPISVGAASGPPRLVPLGQVADIRQTLGPAQVTHLNRER
FT                   VINVQANVQGRSLSEVGADIEKRLDGVKLPPGYMLTTGGESADQAEVFMRVFIALGMAL
FT                   MLMYLILVIQFGSFLDPLAILISLPLSLIGVVLALLITGDTLNLMSLIGIMLLMGIVAK
FT                   NAILLIDFAKWSHEKGMPLREALIEAGRIRLRPIIMTTFALVAGMVPVAIGAGEGGDFR
FT                   APLGRAVIGGTLTSTLLTLLVIPTVYEILVDGRTWSTRMLRKLFRMKPPEQRPHVPGGG
FT                   GGRGEPRPAPQARHD"
     MFISYFAIKR PIITINSMLA LVVFGLVSLG LLETDEFPDV QPPVVSVTIV YPGASPETVE        60
     REILEPIEDA IFAISGVDPK ETTSIATDGL ASFTVFFDFE KDIQEATQDI RDAISSKRAD       120
     LPQEMEEPIL TRFDPADQPI VSLTLTSEGL DVAALSLVAD PTVVGELRSV PGVAQAEVVG       180
     DVAREMTVQL KPEALQAAGL SVAEVVAALQ AQNLAAPVGR INAPLTEESI RLKGRLEKVE       240
     DFRTMVVASR NGRAIRLEQV ADVFVGAEEP RTLALFNGAQ AVGIDVLKAR GYSTTEVADA       300
     VRERVHALQQ RLPAGVKLEI VRDAGVRVEN AVHNVQSALV EGALLTVLVV FVFLNSWRST       360
     VITGLALPVS VLASFISVWA FGFTLNTMSL LGLTLAIGIL IDDAIVVREN IVRHVEMGKD       420
     HYTASREGTS EIGLAVSATT FSIVAVFVPV AFMYGVAGQW FKPFALTIAC AVLVSLFVSF       480
     SLDPMLSAYW PEPPRKQNPG FITRTLNRFN AWFDRQAERY KHVIAWALDH RLVMVLVAVG       540
     SLVGALVLQG TVGGAGFVPV SDRAEVELLV ETPPGSSLEY TRRKVDEVTR TLRAHPEVDY       600
     TYATIGVPLA LSAPGVDQAL VYVRLKPKAE RDMSQDALGV QFREEMKRIG GATVSVFTSG       660
     FGGAFKQLQY ELRGPDQRVL TQLAQQVQKE VEQVAGAVDV GLSTRGQKPE LEVELNRGLA       720
     GQLGVTVGQV AQVLRPAFAG LDVGDWVDPI GETRDVMVRL APGARDNPND LSQLPISVGA       780
     ASGPPRLVPL GQVADIRQTL GPAQVTHLNR ERVINVQANV QGRSLSEVGA DIEKRLDGVK       840
     LPPGYMLTTG GESADQAEVF MRVFIALGMA LMLMYLILVI QFGSFLDPLA ILISLPLSLI       900
     GVVLALLITG DTLNLMSLIG IMLLMGIVAK NAILLIDFAK WSHEKGMPLR EALIEAGRIR       960
     LRPIIMTTFA LVAGMVPVAI GAGEGGDFRA PLGRAVIGGT LTSTLLTLLV IPTVYEILVD      1020
     GRTWSTRMLR KLFRMKPPEQ RPHVPGGGGG RGEPRPAPQA RHD                        1063
//

If you have problems or comments...

PBIL Back to PBIL home page