(data stored in ACNUC30630 zone)

EMBL: CP000113.PE514

CP000113.PE514       Location/Qualifiers
FT   CDS             603538..604842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0531"
FT                   /product="aminotransferase, class I"
FT                   /note="identified by match to protein family HMM PF00155"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92738"
FT                   /db_xref="GOA:Q1DEX3"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEX3"
FT                   /protein_id="ABF92738.1"
FT                   /translation="MAPLDLTSLPRPSKDDATVGTMARGIVGSEILRIAAEIRERIAKG
FT                   QKVCNLTVGDFNPREFPIPDPLREHITAALQAGETNYPPADGVLELRQAVQRFYERSLG
FT                   LKYPLEGIVIAGGARPIIYGTYRSVLDAGETVVYPVPSWNNNHYAHMMDAKSAVVVTDA
FT                   ARGFMPTVEQLAPHLGAARLLCLCSPLNPTGTMIEPDALGAICERVVAENREREKQGRK
FT                   PLILMYDQIYWVLSFGAARHVTPVSLVPEVAPYTVFVDGISKAFAATGVRVGWGVGPPT
FT                   IIARMRDVLGHVGAWAPKAEQVAVARYLDDTAATETFLEGMRKSVEARLEALHKGFTRM
FT                   REAGLPVQHIAPQGAIYLSVRFDLVGKGGLRSNNDIRKLLLEKANLGVVPFQAFGLDAD
FT                   TGWFRLSVGATSVKEIEEALPRVEAALREVLSSGA"
     MAPLDLTSLP RPSKDDATVG TMARGIVGSE ILRIAAEIRE RIAKGQKVCN LTVGDFNPRE        60
     FPIPDPLREH ITAALQAGET NYPPADGVLE LRQAVQRFYE RSLGLKYPLE GIVIAGGARP       120
     IIYGTYRSVL DAGETVVYPV PSWNNNHYAH MMDAKSAVVV TDAARGFMPT VEQLAPHLGA       180
     ARLLCLCSPL NPTGTMIEPD ALGAICERVV AENREREKQG RKPLILMYDQ IYWVLSFGAA       240
     RHVTPVSLVP EVAPYTVFVD GISKAFAATG VRVGWGVGPP TIIARMRDVL GHVGAWAPKA       300
     EQVAVARYLD DTAATETFLE GMRKSVEARL EALHKGFTRM REAGLPVQHI APQGAIYLSV       360
     RFDLVGKGGL RSNNDIRKLL LEKANLGVVP FQAFGLDADT GWFRLSVGAT SVKEIEEALP       420
     RVEAALREVL SSGA                                                         434
//

If you have problems or comments...

PBIL Back to PBIL home page