(data stored in ACNUC30630 zone)

EMBL: CP000113.PE521

CP000113.PE521       Location/Qualifiers
FT   CDS             618427..619377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0538"
FT                   /product="putative lipoprotein"
FT                   /note="identified by match to protein family HMM PF00413"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87456"
FT                   /db_xref="GOA:Q1DEW6"
FT                   /db_xref="InterPro:IPR001818"
FT                   /db_xref="InterPro:IPR006026"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEW6"
FT                   /protein_id="ABF87456.1"
FT                   /translation="MSSRRRIGAAVAQGRSAPGRGWRNRRAAGASPEVGVRGNPKMLKF
FT                   RSVALVAGVALLGSACGGPEASESEPTKMTWEEFRASVYEDPEGKLIFDGDMALDSEEE
FT                   LRAFFDNHVAAETGTSRGGLAVYNTSPTKALSGDVKWSATQARNLTYCVSSTFSGNKAR
FT                   VVTAMNSATAAWEATANVNFTHVTAQDGACTASNNNVLFDVRPVNSGGQYLARAFFPNS
FT                   GRSGRNVLVDNTAFGPISPWTLEGIMRHELGHVLGFRHEHTRSTGSCFEDNAWRALTST
FT                   YDRASVMHYPQCAGTQTGDLVLTTLDKQGARALYP"
     MSSRRRIGAA VAQGRSAPGR GWRNRRAAGA SPEVGVRGNP KMLKFRSVAL VAGVALLGSA        60
     CGGPEASESE PTKMTWEEFR ASVYEDPEGK LIFDGDMALD SEEELRAFFD NHVAAETGTS       120
     RGGLAVYNTS PTKALSGDVK WSATQARNLT YCVSSTFSGN KARVVTAMNS ATAAWEATAN       180
     VNFTHVTAQD GACTASNNNV LFDVRPVNSG GQYLARAFFP NSGRSGRNVL VDNTAFGPIS       240
     PWTLEGIMRH ELGHVLGFRH EHTRSTGSCF EDNAWRALTS TYDRASVMHY PQCAGTQTGD       300
     LVLTTLDKQG ARALYP                                                       316
//

If you have problems or comments...

PBIL Back to PBIL home page