(data stored in ACNUC30630 zone)

EMBL: CP000113.PE522

CP000113.PE522       Location/Qualifiers
FT   CDS             complement(619505..619969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0539"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88704"
FT                   /db_xref="InterPro:IPR035223"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEW5"
FT                   /protein_id="ABF88704.1"
FT                   /translation="MPGKQARSTPRTHKPYGFAEQRNPEGKHMHHTREIPREGWGDYLA
FT                   LLSNLERDHWVRIETESVDFGDQPLAGRLPLVEIALESKGSDQGSVEIIVGRPGGEVTH
FT                   RILKPDHIYADESESGELECLDIEDADQVKTLIFFEPQRAGDELGIGAPS"
     MPGKQARSTP RTHKPYGFAE QRNPEGKHMH HTREIPREGW GDYLALLSNL ERDHWVRIET        60
     ESVDFGDQPL AGRLPLVEIA LESKGSDQGS VEIIVGRPGG EVTHRILKPD HIYADESESG       120
     ELECLDIEDA DQVKTLIFFE PQRAGDELGI GAPS                                   154
//

If you have problems or comments...

PBIL Back to PBIL home page