(data stored in ACNUC30630 zone)

EMBL: CP000113.PE526

CP000113.PE526       Location/Qualifiers
FT   CDS             624930..626510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0543"
FT                   /product="peptidase, M20 (glutamate carboxypeptidase)
FT                   family"
FT                   /EC_number="3.4.-.-"
FT                   /note="identified by match to protein family HMM PF01546;
FT                   match to protein family HMM PF07687"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91458"
FT                   /db_xref="GOA:Q1DEW1"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEW1"
FT                   /protein_id="ABF91458.1"
FT                   /translation="MAPAPVLPGVPGWGVFSASDGGHQRHPASWWIPAVDRGPSPVFWI
FT                   RPDMAMNVQTATDSSDRIWEQEILPALERYIRIPNKSPAFDPDWVRSGHMEAAVQLVAD
FT                   WCLAQAQHLPGLVLEVVRLKDEKGRERTPVIYMEVPGTKGDDTILLYGHLDKQPEMTGW
FT                   REGLTPWTPVREGDKLYGRGGADDGYSAFASLTAIRLLREQGLPHARCVVLIEACEESG
FT                   SYDLPAYIEALAPRIGKPSLVVCLDSGCANYEQLWMTTSLRGMVAGNLRVDVLTEGVHS
FT                   GDASGIVPSSFRVLRQVLSRVEEEGTGKVLVEALHTQIPEARRDQARAAAKVLGEEVFT
FT                   KFPWVPGIRPMSDDGAELVLNRTWRPALSVTGVDGMPALNSAGNVLRPFTTVKLSMRIP
FT                   PRVDPKAAMDALTQTLVKDPPYGATVTFEGEKSSTGWDAPPLASWLSNAVESASATYFG
FT                   RPAMAMGEGGTIPFMGMLGERFPEAQFLITGLLGPGSNAHGPNEFLHIPTGKKLTCCVA
FT                   SVIADHFKR"
     MAPAPVLPGV PGWGVFSASD GGHQRHPASW WIPAVDRGPS PVFWIRPDMA MNVQTATDSS        60
     DRIWEQEILP ALERYIRIPN KSPAFDPDWV RSGHMEAAVQ LVADWCLAQA QHLPGLVLEV       120
     VRLKDEKGRE RTPVIYMEVP GTKGDDTILL YGHLDKQPEM TGWREGLTPW TPVREGDKLY       180
     GRGGADDGYS AFASLTAIRL LREQGLPHAR CVVLIEACEE SGSYDLPAYI EALAPRIGKP       240
     SLVVCLDSGC ANYEQLWMTT SLRGMVAGNL RVDVLTEGVH SGDASGIVPS SFRVLRQVLS       300
     RVEEEGTGKV LVEALHTQIP EARRDQARAA AKVLGEEVFT KFPWVPGIRP MSDDGAELVL       360
     NRTWRPALSV TGVDGMPALN SAGNVLRPFT TVKLSMRIPP RVDPKAAMDA LTQTLVKDPP       420
     YGATVTFEGE KSSTGWDAPP LASWLSNAVE SASATYFGRP AMAMGEGGTI PFMGMLGERF       480
     PEAQFLITGL LGPGSNAHGP NEFLHIPTGK KLTCCVASVI ADHFKR                      526
//

If you have problems or comments...

PBIL Back to PBIL home page