(data stored in ACNUC30630 zone)

EMBL: CP000113.PE533

CP000113.PE533       Location/Qualifiers
FT   CDS             complement(632639..633613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0550"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89356"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEV4"
FT                   /protein_id="ABF89356.1"
FT                   /translation="MKRLCLLLTLPLFPLLSTDAHAASTDTHPALRASTCSVRGLMDDI
FT                   RRGLGSGSPSYQRYLRTLLREAAVTLPDAELRDAFARETDPVMAEHLAAALVARAEREA
FT                   DTQAMDVVAQRALHDADPSVRAATLRAMRRTSALERTGDLYERMVRDESPQVRQEAATN
FT                   LIEDNAHVYAGQYGPAADTAVTAAVASTDPAVTARILDNLSTEKISAESADRITSLLRS
FT                   DDASVRKAAVNALGGVPAEQMQGARESLLAMYREETDEGVRKALLQSVAQLGFEGAIPD
FT                   LQRMRAMDPRLAQEADAWIQVLGMGLQEWSLLLREKQRLQQAP"
     MKRLCLLLTL PLFPLLSTDA HAASTDTHPA LRASTCSVRG LMDDIRRGLG SGSPSYQRYL        60
     RTLLREAAVT LPDAELRDAF ARETDPVMAE HLAAALVARA EREADTQAMD VVAQRALHDA       120
     DPSVRAATLR AMRRTSALER TGDLYERMVR DESPQVRQEA ATNLIEDNAH VYAGQYGPAA       180
     DTAVTAAVAS TDPAVTARIL DNLSTEKISA ESADRITSLL RSDDASVRKA AVNALGGVPA       240
     EQMQGARESL LAMYREETDE GVRKALLQSV AQLGFEGAIP DLQRMRAMDP RLAQEADAWI       300
     QVLGMGLQEW SLLLREKQRL QQAP                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page