(data stored in ACNUC30630 zone)

EMBL: CP000113.PE536

CP000113.PE536       Location/Qualifiers
FT   CDS             complement(636733..637479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0553"
FT                   /product="ABC transporter, permease protein, ABC-2 family"
FT                   /note="identified by match to protein family HMM PF01061"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86762"
FT                   /db_xref="GOA:Q1DEV1"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEV1"
FT                   /protein_id="ABF86762.1"
FT                   /translation="MKTLLAKEVRRFMRVPGQTVLSPLISTTLYFIVFGVSISGRVQTV
FT                   EGLPYLHFIVPGLVFLGIANNAFLNSSSSLFITKIQGTVVDLLVAPLGPGELMAGFIGG
FT                   AMVRGLVVGLLTWAVATFFTGFSLEHAGVAAYFLILSSYVFSVLGMLAAVWAEKFEQIN
FT                   FFPTFVMLPLTFLGGVFYSVRELPAPWNTVSLFNPMVYMVEGLRYGMLGRSIYSPLGAG
FT                   SILFAVAVAATALTYAVLRSGYKMKA"
     MKTLLAKEVR RFMRVPGQTV LSPLISTTLY FIVFGVSISG RVQTVEGLPY LHFIVPGLVF        60
     LGIANNAFLN SSSSLFITKI QGTVVDLLVA PLGPGELMAG FIGGAMVRGL VVGLLTWAVA       120
     TFFTGFSLEH AGVAAYFLIL SSYVFSVLGM LAAVWAEKFE QINFFPTFVM LPLTFLGGVF       180
     YSVRELPAPW NTVSLFNPMV YMVEGLRYGM LGRSIYSPLG AGSILFAVAV AATALTYAVL       240
     RSGYKMKA                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page