(data stored in ACNUC30630 zone)

EMBL: CP000113.PE537

CP000113.PE537       Location/Qualifiers
FT   CDS             complement(637504..638436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0554"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92427"
FT                   /db_xref="GOA:Q1DEV0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEV0"
FT                   /protein_id="ABF92427.1"
FT                   /translation="MSVPALELQGLSKRYGEFTALHTVDLAIRPGEIFALLGPNGAGKT
FT                   TMIGSVCGLVKKSSGSIRVFGKDLDQDPVGPRYDIGLVPQEINFDPFFTVAESLRIQLG
FT                   FYGRPADEARIDEVLTALNLHAKKDAYTRALSGGMKRRLLIAKALVHKPRLVFLDEPTA
FT                   GVDVELRRDLWTYVRKLASEGTTIVLTTHYLEEAEELADRVGIINEGRLLMVEDKATLL
FT                   RRFGERRVIITFEQPQPGLSEAGKRFAARLSEDGRTLTYVERDGCAPSGELLRALYAEG
FT                   QLISDVETRRSRMEDVLIEILRGRPQQAA"
     MSVPALELQG LSKRYGEFTA LHTVDLAIRP GEIFALLGPN GAGKTTMIGS VCGLVKKSSG        60
     SIRVFGKDLD QDPVGPRYDI GLVPQEINFD PFFTVAESLR IQLGFYGRPA DEARIDEVLT       120
     ALNLHAKKDA YTRALSGGMK RRLLIAKALV HKPRLVFLDE PTAGVDVELR RDLWTYVRKL       180
     ASEGTTIVLT THYLEEAEEL ADRVGIINEG RLLMVEDKAT LLRRFGERRV IITFEQPQPG       240
     LSEAGKRFAA RLSEDGRTLT YVERDGCAPS GELLRALYAE GQLISDVETR RSRMEDVLIE       300
     ILRGRPQQAA                                                              310
//

If you have problems or comments...

PBIL Back to PBIL home page