(data stored in ACNUC30630 zone)

EMBL: CP000113.PE539

CP000113.PE539       Location/Qualifiers
FT   CDS             complement(639479..640906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0556"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="identified by match to protein family HMM PF00155;
FT                   match to protein family HMM PF00392"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86680"
FT                   /db_xref="GOA:Q1DEU8"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEU8"
FT                   /protein_id="ABF86680.1"
FT                   /translation="MDLHVDLQDRRDVAGQIYRGLRARILDGRLRDGEQVPPSRELAQR
FT                   LGVSRNTVGVAYEWLTAEGLLVGRGRAGSFVQNAPRERGARAAATRGVKLRPRAVWSEL
FT                   HVPPPAEPPAPYDFRVGNPDAALFPFEAWHRLLARHLRAAAMTAAYADPAGHPELREAV
FT                   ARHVGVSRGVRAEASDVLITHGAQQALDLAGRVLLEPGDRVAVEEPGYPPARLLFQSLG
FT                   AHVVPVPVDKEGLDVQALPDDTRLVYVTPSHQFPLGIVMSPARRRALLDWARRRDAVVI
FT                   EDDYDSEFRFGGRPLETLHSLDRSGRVLYVGSFSKVLLPALRLGFLVAPPSLQRELRLA
FT                   KQVTDWHSQLPAQAALARFIDTGALARHLRKTRREYEQRHTRLSEKLRHHFGDALEQLP
FT                   SVAGLHLCVTFTRGGARLERELTRRARDAGIGIEALSGYFAGAPTRHGWVLGYGGVTVD
FT                   RIDEGLWRLRTRLAGAL"
     MDLHVDLQDR RDVAGQIYRG LRARILDGRL RDGEQVPPSR ELAQRLGVSR NTVGVAYEWL        60
     TAEGLLVGRG RAGSFVQNAP RERGARAAAT RGVKLRPRAV WSELHVPPPA EPPAPYDFRV       120
     GNPDAALFPF EAWHRLLARH LRAAAMTAAY ADPAGHPELR EAVARHVGVS RGVRAEASDV       180
     LITHGAQQAL DLAGRVLLEP GDRVAVEEPG YPPARLLFQS LGAHVVPVPV DKEGLDVQAL       240
     PDDTRLVYVT PSHQFPLGIV MSPARRRALL DWARRRDAVV IEDDYDSEFR FGGRPLETLH       300
     SLDRSGRVLY VGSFSKVLLP ALRLGFLVAP PSLQRELRLA KQVTDWHSQL PAQAALARFI       360
     DTGALARHLR KTRREYEQRH TRLSEKLRHH FGDALEQLPS VAGLHLCVTF TRGGARLERE       420
     LTRRARDAGI GIEALSGYFA GAPTRHGWVL GYGGVTVDRI DEGLWRLRTR LAGAL            475
//

If you have problems or comments...

PBIL Back to PBIL home page