(data stored in ACNUC30630 zone)

EMBL: CP000113.PE540

CP000113.PE540       Location/Qualifiers
FT   CDS             640991..641455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0557"
FT                   /product="cupin domain protein"
FT                   /note="identified by match to protein family HMM PF07883"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89392"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEU7"
FT                   /protein_id="ABF89392.1"
FT                   /translation="MNDTSSSSVSSRPVDPERMPWIPMGPAGLSFKPLRFFQDGSGWMY
FT                   LFRLEPGTVIPRHRHTGEAHGFNLSGTRELLDTGEVIGPGGYVYEPPGNVDSWRVTGDA
FT                   PAVLLITVRGAIEYLTEDGQVSKRVTSEERLQTYRRWCEANSAPFLATLE"
     MNDTSSSSVS SRPVDPERMP WIPMGPAGLS FKPLRFFQDG SGWMYLFRLE PGTVIPRHRH        60
     TGEAHGFNLS GTRELLDTGE VIGPGGYVYE PPGNVDSWRV TGDAPAVLLI TVRGAIEYLT       120
     EDGQVSKRVT SEERLQTYRR WCEANSAPFL ATLE                                   154
//

If you have problems or comments...

PBIL Back to PBIL home page