(data stored in ACNUC30630 zone)

EMBL: CP000113.PE55

CP000113.PE55        Location/Qualifiers
FT   CDS             65246..65800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0058"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89425"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG82"
FT                   /protein_id="ABF89425.1"
FT                   /translation="MRRFSRGLAVLLAVAGLSSAAASDDVVGYEAPSEEALRCLSEDLP
FT                   VTVKVDYVLTGCWVFTQSTFYLKVTQSGAEVSGRGDDWEDPVKLSPRKLSRAEGERILQ
FT                   DLTSVMLRRESESASGHAPTRYVTTVEWVCGGVRGTKRGTVAFTAPAYDLYSTDEEEGD
FT                   TSARAVGVRDVVVKALRQAHR"
     MRRFSRGLAV LLAVAGLSSA AASDDVVGYE APSEEALRCL SEDLPVTVKV DYVLTGCWVF        60
     TQSTFYLKVT QSGAEVSGRG DDWEDPVKLS PRKLSRAEGE RILQDLTSVM LRRESESASG       120
     HAPTRYVTTV EWVCGGVRGT KRGTVAFTAP AYDLYSTDEE EGDTSARAVG VRDVVVKALR       180
     QAHR                                                                    184
//

If you have problems or comments...

PBIL Back to PBIL home page