(data stored in ACNUC30630 zone)

EMBL: CP000113.PE553

CP000113.PE553       Location/Qualifiers
FT   CDS             656627..657088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0570"
FT                   /product="thermonuclease family protein"
FT                   /note="identified by match to protein family HMM PF00565"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86838"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DET4"
FT                   /protein_id="ABF86838.1"
FT                   /translation="MACLLAACGGGDAEVSCGPASGRVAEVLDGDTVVLESGERVRYLL
FT                   ADAPERTGTGGDCFGPEAHAFNRGLVEGRRVALTYGEACEDRFGRLLAYVSVEGREVNT
FT                   LLVERGHACVLHVPPAGRSRRAEFQALEAQARLARRGVWGACAPVSCQR"
     MACLLAACGG GDAEVSCGPA SGRVAEVLDG DTVVLESGER VRYLLADAPE RTGTGGDCFG        60
     PEAHAFNRGL VEGRRVALTY GEACEDRFGR LLAYVSVEGR EVNTLLVERG HACVLHVPPA       120
     GRSRRAEFQA LEAQARLARR GVWGACAPVS CQR                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page