(data stored in ACNUC30630 zone)

EMBL: CP000113.PE561

CP000113.PE561       Location/Qualifiers
FT   CDS             complement(663275..663889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0579"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06080"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87671"
FT                   /db_xref="InterPro:IPR010342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DES6"
FT                   /protein_id="ABF87671.1"
FT                   /translation="MKRHAPATERNREPLLAVLREVLPASGRVLEVASGTGQHAAWFAR
FT                   ALPHLVWQPTDVDAESLESIEAWRTAEGPPNLLPPRQLDASAASWPETAADVILNVNMI
FT                   HIAPWTACQGLMRGAGRVLPPGGLLVLYGPYFVEGRETAPSNLEFDASLRARNPAWGVR
FT                   SLEAVTAEAALHGLERERVVDMPSNNLTVVFRKPRPQVSPH"
     MKRHAPATER NREPLLAVLR EVLPASGRVL EVASGTGQHA AWFARALPHL VWQPTDVDAE        60
     SLESIEAWRT AEGPPNLLPP RQLDASAASW PETAADVILN VNMIHIAPWT ACQGLMRGAG       120
     RVLPPGGLLV LYGPYFVEGR ETAPSNLEFD ASLRARNPAW GVRSLEAVTA EAALHGLERE       180
     RVVDMPSNNL TVVFRKPRPQ VSPH                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page