(data stored in ACNUC30630 zone)

EMBL: CP000113.PE562

CP000113.PE562       Location/Qualifiers
FT   CDS             663974..664468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0580"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89289"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DES5"
FT                   /protein_id="ABF89289.1"
FT                   /translation="MGGAGRGPLAVTPGPGWKKRSVHARLFPTRQFPAPPGQAGVSPSG
FT                   GLWGVHWGHGSTAGGQVGRYLWRYRLPKRKVHPGLPFLPGERALGCTPAPAGYTARRGS
FT                   QAGRGASHMCTVPCCRGPACHTFGGAGLKPNSEESHHHSRTEKQPRREPRPENQPSHPC
FT                   P"
     MGGAGRGPLA VTPGPGWKKR SVHARLFPTR QFPAPPGQAG VSPSGGLWGV HWGHGSTAGG        60
     QVGRYLWRYR LPKRKVHPGL PFLPGERALG CTPAPAGYTA RRGSQAGRGA SHMCTVPCCR       120
     GPACHTFGGA GLKPNSEESH HHSRTEKQPR REPRPENQPS HPCP                        164
//

If you have problems or comments...

PBIL Back to PBIL home page