(data stored in ACNUC30630 zone)

EMBL: CP000113.PE568

CP000113.PE568       Location/Qualifiers
FT   CDS             673260..675470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0586"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89506"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DER9"
FT                   /protein_id="ABF89506.1"
FT                   /translation="MGLAVAVAVLLAATPTFVTRGDVTPEAGLRREAEAAWTALEARYV
FT                   QEAGGAPAKPPASIVLQKGAALSPQRNGQGRPGLVELRQNTPGMLDERLRLALRHELAH
FT                   QFLWWACPQSSEDRLFHEAFSVAVSGELPSWKEGPYLSLSRAASVLAGAPEVDTPRARR
FT                   ALARLLNESPGFSPALSRRLRQCQDGARWASPLSIDELAGVGVREARPATVVVSRHSGE
FT                   VLLSEGDVRRALPYGSVLKPFLYAAGAEHPTLPPRPGVPEWVCGAGVPAKVDARTALLR
FT                   SCNGYYLDWEARGSAPRAFGAWGPVLASVGLTGLPEDMAEATGLRSTLAVSPWGVAQAY
FT                   RLLAEARPDVVALLADNAARGTLAELPASESLVGVATKTGTVRDAASRPQFGWIAAVDP
FT                   DLVAVVVRPGAMPRQFAEEVPKALARARKQAGLEAARVQVLGLLPPGDVEARCSGAGFA
FT                   LVEGVPRAGEEAWTPLASLTQRGAAVCLGAPWRVRFPGGPGEGRDYAGVFITSEPPPYR
FT                   PPPGVPTTPSAMKARRGSDFVFRTTRLQYAAGVVSAEDVTLTGEARVALARVVAHNEQH
FT                   GHSRHPGRPVCDTTHCQAFRGTVRVRSEDAKALGLAPLKWRKWLTFSQGGEEPWRQARP
FT                   RAEVERLLGRGLVSLHFKAGRVHYLRAETDGDATFDTARSVPCDLLRSGLKLPSCPRTA
FT                   SFNGESLMFEGRGRGHGEGLDVEAAKAAGSGSDVILDDAYGQ"
     MGLAVAVAVL LAATPTFVTR GDVTPEAGLR REAEAAWTAL EARYVQEAGG APAKPPASIV        60
     LQKGAALSPQ RNGQGRPGLV ELRQNTPGML DERLRLALRH ELAHQFLWWA CPQSSEDRLF       120
     HEAFSVAVSG ELPSWKEGPY LSLSRAASVL AGAPEVDTPR ARRALARLLN ESPGFSPALS       180
     RRLRQCQDGA RWASPLSIDE LAGVGVREAR PATVVVSRHS GEVLLSEGDV RRALPYGSVL       240
     KPFLYAAGAE HPTLPPRPGV PEWVCGAGVP AKVDARTALL RSCNGYYLDW EARGSAPRAF       300
     GAWGPVLASV GLTGLPEDMA EATGLRSTLA VSPWGVAQAY RLLAEARPDV VALLADNAAR       360
     GTLAELPASE SLVGVATKTG TVRDAASRPQ FGWIAAVDPD LVAVVVRPGA MPRQFAEEVP       420
     KALARARKQA GLEAARVQVL GLLPPGDVEA RCSGAGFALV EGVPRAGEEA WTPLASLTQR       480
     GAAVCLGAPW RVRFPGGPGE GRDYAGVFIT SEPPPYRPPP GVPTTPSAMK ARRGSDFVFR       540
     TTRLQYAAGV VSAEDVTLTG EARVALARVV AHNEQHGHSR HPGRPVCDTT HCQAFRGTVR       600
     VRSEDAKALG LAPLKWRKWL TFSQGGEEPW RQARPRAEVE RLLGRGLVSL HFKAGRVHYL       660
     RAETDGDATF DTARSVPCDL LRSGLKLPSC PRTASFNGES LMFEGRGRGH GEGLDVEAAK       720
     AAGSGSDVIL DDAYGQ                                                       736
//

If you have problems or comments...

PBIL Back to PBIL home page