(data stored in ACNUC30630 zone)

EMBL: CP000113.PE571

CP000113.PE571       Location/Qualifiers
FT   CDS             679437..681359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0589"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86609"
FT                   /db_xref="InterPro:IPR011030"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DER6"
FT                   /protein_id="ABF86609.1"
FT                   /translation="MRRSRLAVRTAALTTTLLFVGAVPVWSYFHHATPEAVVAAAPVSA
FT                   SRLPLYRWTVGEERTYHFVWNDLQRVALPVPQQGDAPQTMDGTLSLEGELTLQALEVRA
FT                   NGARVRLAVKRLDRHDATLSGQALFPDAAAVQAHLPQTASAWLELDARGALVAVRFSDA
FT                   EPPLFRQVAQTLAAELFPTELRDAAEWSAVESTQTGEVEARFQFDGEDARLTRRRARYQ
FT                   SLRAAATAPAFRQTLSSLTHFDRDPEGFLAGVSHDEILDATHTDGRSLMSRRVRLRLAF
FT                   STRQQKPLPPATEDKPIVRAPSQVAFEGDEALALTTSQADGMTVDAALQVLASATDPGA
FT                   IPELGTFARRAIAALKLEPHRAGELGQLFLQKGRSPAMRELMLDLLAGAGHAEAQATLR
FT                   ELIVSTEAREHAGAHGLMVQRAGLLREPEPETGRLLARMNTEARTAGDVGAERASAYAL
FT                   GAVVSRLPAGSPEVAEFLRPLEDALARADNAESLEHSLRALGNSGTERVMDLASPHLRD
FT                   EAPEVRSAAAGALRTAPQEAATRMLLDALMSEPARAVQGALLDALNARTLGAPELERLS
FT                   GWVVAGQLAPGAEAALLNVLTPRMDDSAAVLRMLQALSVRPGQQPATRARVMALMAQAS
FT                   ASRGG"
     MRRSRLAVRT AALTTTLLFV GAVPVWSYFH HATPEAVVAA APVSASRLPL YRWTVGEERT        60
     YHFVWNDLQR VALPVPQQGD APQTMDGTLS LEGELTLQAL EVRANGARVR LAVKRLDRHD       120
     ATLSGQALFP DAAAVQAHLP QTASAWLELD ARGALVAVRF SDAEPPLFRQ VAQTLAAELF       180
     PTELRDAAEW SAVESTQTGE VEARFQFDGE DARLTRRRAR YQSLRAAATA PAFRQTLSSL       240
     THFDRDPEGF LAGVSHDEIL DATHTDGRSL MSRRVRLRLA FSTRQQKPLP PATEDKPIVR       300
     APSQVAFEGD EALALTTSQA DGMTVDAALQ VLASATDPGA IPELGTFARR AIAALKLEPH       360
     RAGELGQLFL QKGRSPAMRE LMLDLLAGAG HAEAQATLRE LIVSTEAREH AGAHGLMVQR       420
     AGLLREPEPE TGRLLARMNT EARTAGDVGA ERASAYALGA VVSRLPAGSP EVAEFLRPLE       480
     DALARADNAE SLEHSLRALG NSGTERVMDL ASPHLRDEAP EVRSAAAGAL RTAPQEAATR       540
     MLLDALMSEP ARAVQGALLD ALNARTLGAP ELERLSGWVV AGQLAPGAEA ALLNVLTPRM       600
     DDSAAVLRML QALSVRPGQQ PATRARVMAL MAQASASRGG                             640
//

If you have problems or comments...

PBIL Back to PBIL home page