(data stored in ACNUC30630 zone)

EMBL: CP000113.PE581

CP000113.PE581       Location/Qualifiers
FT   CDS             690915..692597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0599"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAD01926.1; match to
FT                   protein family HMM PF03235; match to protein family HMM
FT                   PF07510"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90819"
FT                   /db_xref="InterPro:IPR004919"
FT                   /db_xref="InterPro:IPR011089"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEQ6"
FT                   /protein_id="ABF90819.1"
FT                   /translation="MDIKGEQRPIQKVFCDDFVLRVPHYQRPYAWKLENAQELLSDLLA
FT                   FMGGGSTKVDELPPYFLGSIVLVKDDAWPEAEVIDGQQRLTTLTILLAALRASTGAAFG
FT                   SDLTKYLYQPGSLVEGTPDQYRLRLRDRDAEFFREFVQAVDGPAKLKALTREIPDAQQR
FT                   IRENALLFLRELDALPVERRQRLASYLVRRCYLVVVSTPDADSAYRIFSVLNDRGLDLS
FT                   HADILKADIVGKIDGEALQKAYATKWEEVEEEIGRDAFKDLFGHLRMIHRRAKLEGTVL
FT                   AEFRKYVVDKAPEPRKLVDDVIVAGAWAYDQIRRCSWDGQSDDATQAKIEELLEWLNRL
FT                   DNEDWVPPAIRVMQLSADATKVLRHLEALERLAAFLLIKRSNVNERIHRYANVLEAIEN
FT                   GTAIDAGGPLLLSTDEEKQLVDALDGEVYLEQKVRVYVLLRLDRALGDKGAKYDVDTIT
FT                   VEHVLPQNPRDKSEWLTNFPRPEDRAWTHRIGNLLLLPRRKNSEASNWDFGEKKKRYFT
FT                   SKKGVSTFALTSQVLKESAWTPDVVARRQTEAIDTLKKVWSLK"
     MDIKGEQRPI QKVFCDDFVL RVPHYQRPYA WKLENAQELL SDLLAFMGGG STKVDELPPY        60
     FLGSIVLVKD DAWPEAEVID GQQRLTTLTI LLAALRASTG AAFGSDLTKY LYQPGSLVEG       120
     TPDQYRLRLR DRDAEFFREF VQAVDGPAKL KALTREIPDA QQRIRENALL FLRELDALPV       180
     ERRQRLASYL VRRCYLVVVS TPDADSAYRI FSVLNDRGLD LSHADILKAD IVGKIDGEAL       240
     QKAYATKWEE VEEEIGRDAF KDLFGHLRMI HRRAKLEGTV LAEFRKYVVD KAPEPRKLVD       300
     DVIVAGAWAY DQIRRCSWDG QSDDATQAKI EELLEWLNRL DNEDWVPPAI RVMQLSADAT       360
     KVLRHLEALE RLAAFLLIKR SNVNERIHRY ANVLEAIENG TAIDAGGPLL LSTDEEKQLV       420
     DALDGEVYLE QKVRVYVLLR LDRALGDKGA KYDVDTITVE HVLPQNPRDK SEWLTNFPRP       480
     EDRAWTHRIG NLLLLPRRKN SEASNWDFGE KKKRYFTSKK GVSTFALTSQ VLKESAWTPD       540
     VVARRQTEAI DTLKKVWSLK                                                   560
//

If you have problems or comments...

PBIL Back to PBIL home page