(data stored in ACNUC30630 zone)

EMBL: CP000113.PE583

CP000113.PE583       Location/Qualifiers
FT   CDS             complement(693442..693819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0601"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87507"
FT                   /db_xref="InterPro:IPR011753"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEQ4"
FT                   /protein_id="ABF87507.1"
FT                   /translation="MADELEWEPVRALARRVREGERLTLTAEVREMLERTAPEVGIGKA
FT                   DAAAALATAEKAEALLLECARRIKEGSDRIVDALYRAKRHRKAGDFDSARQEMREVLAI
FT                   EVVPLYREIAEGQLEDMAEEP"
     MADELEWEPV RALARRVREG ERLTLTAEVR EMLERTAPEV GIGKADAAAA LATAEKAEAL        60
     LLECARRIKE GSDRIVDALY RAKRHRKAGD FDSARQEMRE VLAIEVVPLY REIAEGQLED       120
     MAEEP                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page