(data stored in ACNUC30630 zone)

EMBL: CP000113.PE584

CP000113.PE584       Location/Qualifiers
FT   CDS             complement(694361..695332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0602"
FT                   /product="cytochrome oxidase assembly protein"
FT                   /note="identified by match to protein family HMM PF02628"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89276"
FT                   /db_xref="GOA:Q1DEQ3"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEQ3"
FT                   /protein_id="ABF89276.1"
FT                   /translation="MTHAASSRRFQAFSLGVLAFTLVVILWGAFVRATGSGAGCGDHWP
FT                   VCNGEVIPRAPSVQTLIEYTHRLTSGLAMILAVALYVWARKGHAKGHPVRSAAAWALFF
FT                   MMTEALVGAGIVLLKYVADNASVGRALWMGVHLVNTFLLVGAQTLVIWFSRGRAPLSLR
FT                   GQGLPGALMGLSILGLLVLGVSGAIAALGDTLFPSTTLAEGLRQDISETAHILIKLRVL
FT                   HPLLAVSVGAFLVLASRWVARVRPSEDVRRAASAITVLYAVQLGAGVTNLLLLAPVWMQ
FT                   LVHLLLADFVWMAVVVLCAAGLAADAPRVVAEASPASSAEPV"
     MTHAASSRRF QAFSLGVLAF TLVVILWGAF VRATGSGAGC GDHWPVCNGE VIPRAPSVQT        60
     LIEYTHRLTS GLAMILAVAL YVWARKGHAK GHPVRSAAAW ALFFMMTEAL VGAGIVLLKY       120
     VADNASVGRA LWMGVHLVNT FLLVGAQTLV IWFSRGRAPL SLRGQGLPGA LMGLSILGLL       180
     VLGVSGAIAA LGDTLFPSTT LAEGLRQDIS ETAHILIKLR VLHPLLAVSV GAFLVLASRW       240
     VARVRPSEDV RRAASAITVL YAVQLGAGVT NLLLLAPVWM QLVHLLLADF VWMAVVVLCA       300
     AGLAADAPRV VAEASPASSA EPV                                               323
//

If you have problems or comments...

PBIL Back to PBIL home page