(data stored in ACNUC30630 zone)

EMBL: CP000113.PE597

CP000113.PE597       Location/Qualifiers
FT   CDS             complement(713535..714608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0615"
FT                   /product="DNA ligase, ATP-dependent"
FT                   /EC_number="6.5.1.1"
FT                   /note="identified by similarity to SP:P44121; match to
FT                   protein family HMM PF01068"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91525"
FT                   /db_xref="GOA:Q1DEP0"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016059"
FT                   /db_xref="InterPro:IPR029319"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEP0"
FT                   /protein_id="ABF91525.1"
FT                   /translation="MRHGGSVMADIADGEQVSVQGSGSKPYILKNTGGVYSCSCPAWRN
FT                   QSVAIERRTCKHLRRVRGDAAEDARIGGDGSGAPAVPARPTRSTSASDDTKAPPLLLAQ
FT                   SWENDVDLTGWWMSEKLDGVRAYWDGKQFWSRLGNAFLAPEWFTAGLPDFPLDGELFGG
FT                   RKRFQRTVSIVRRQDRSDDWKELAFVAFDAPGVEGTFEARLERCRQWMEEAKPAYAQWH
FT                   AHARCDGTPHLRTELARVESLGGEGLMLRQPGSRYEAGRSHTLLKVKSFKDDEARVVGH
FT                   VAGAGRHKGRLGALEVELRNGTRFSVGTGLSDAERASPPPVGAIITFRYQELSNDGVPR
FT                   FPSYVGVRVDAAPFAAS"
     MRHGGSVMAD IADGEQVSVQ GSGSKPYILK NTGGVYSCSC PAWRNQSVAI ERRTCKHLRR        60
     VRGDAAEDAR IGGDGSGAPA VPARPTRSTS ASDDTKAPPL LLAQSWENDV DLTGWWMSEK       120
     LDGVRAYWDG KQFWSRLGNA FLAPEWFTAG LPDFPLDGEL FGGRKRFQRT VSIVRRQDRS       180
     DDWKELAFVA FDAPGVEGTF EARLERCRQW MEEAKPAYAQ WHAHARCDGT PHLRTELARV       240
     ESLGGEGLML RQPGSRYEAG RSHTLLKVKS FKDDEARVVG HVAGAGRHKG RLGALEVELR       300
     NGTRFSVGTG LSDAERASPP PVGAIITFRY QELSNDGVPR FPSYVGVRVD AAPFAAS          357
//

If you have problems or comments...

PBIL Back to PBIL home page