(data stored in ACNUC30630 zone)

EMBL: CP000113.PE599

CP000113.PE599       Location/Qualifiers
FT   CDS             715363..716004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0617"
FT                   /product="putative carbonic anhydrase"
FT                   /note="identified by similarity to GB:AAR82947.1; match to
FT                   protein family HMM PF00484"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87641"
FT                   /db_xref="GOA:Q1DEN8"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEN8"
FT                   /protein_id="ABF87641.1"
FT                   /translation="MPTASTPPISAQDALARLREGNQRFVLNARNMENPLGRSARQALV
FT                   AGQSPFAIILSCSDSRAPSEYIFDQGLGDLFVIRVAGNVVAPSLVGSVEFAAAKFGTRL
FT                   AVVMGHSHCGAIQATLDYLRDGKSEASENIRDIVERCREPVATVVSAAGPKADPEFLMK
FT                   ESVRANIRNSCDNLRHGSRLLERLCREEGMLIVGAEYSLETGAVDFFNGV"
     MPTASTPPIS AQDALARLRE GNQRFVLNAR NMENPLGRSA RQALVAGQSP FAIILSCSDS        60
     RAPSEYIFDQ GLGDLFVIRV AGNVVAPSLV GSVEFAAAKF GTRLAVVMGH SHCGAIQATL       120
     DYLRDGKSEA SENIRDIVER CREPVATVVS AAGPKADPEF LMKESVRANI RNSCDNLRHG       180
     SRLLERLCRE EGMLIVGAEY SLETGAVDFF NGV                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page