(data stored in ACNUC30630 zone)

EMBL: CP000113.PE61

CP000113.PE61        Location/Qualifiers
FT   CDS             complement(73389..74741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0064"
FT                   /product="conserved hypothetical protein, UPF0027 family"
FT                   /note="identified by match to protein family HMM PF01139"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABF85892"
FT                   /db_xref="GOA:Q1DG76"
FT                   /db_xref="InterPro:IPR001233"
FT                   /db_xref="InterPro:IPR036025"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG76"
FT                   /protein_id="ABF85892.1"
FT                   /translation="MSWKQRLEKVSEGHYVLAKTKSMKVDADLFLSDKLLWGEGPEQPG
FT                   LEDSVFDQVVNAASFPGVTRVAVTPDCHLGYGVPIGTVVETDGILLPTAAGYDIGCGMV
FT                   QLQTTLTAEDVADATKRRRWIEEVTKRIAVGVGASRVQKQRRVTDRTFADVVRHGAKAL
FT                   GRGSSVTERDYIPVEDDRVDIPERAFGKREQLGSLGGGNHFTEMQVDQDGRVWVMLHTG
FT                   SRGFGWNIAKHFFVEGAAQLGLKSRSEDHVWLDAESPLGRDYWNLHNMAANFAVANRLI
FT                   IGEAVCAALEDVFGGTASVYYEISHNLIQKEAGKFVARKGATRAFPGGHPALKGTPWEK
FT                   TGHPILIPGSMETGSAILFAEPGAQKSIYSVNHGSGRRMSRGEARRVLKQDVTDKRMAE
FT                   AGILLNTRQTPLDESGPCYKNLDDVLETVEMAGLARVAYRLKPVACIKGAD"
     MSWKQRLEKV SEGHYVLAKT KSMKVDADLF LSDKLLWGEG PEQPGLEDSV FDQVVNAASF        60
     PGVTRVAVTP DCHLGYGVPI GTVVETDGIL LPTAAGYDIG CGMVQLQTTL TAEDVADATK       120
     RRRWIEEVTK RIAVGVGASR VQKQRRVTDR TFADVVRHGA KALGRGSSVT ERDYIPVEDD       180
     RVDIPERAFG KREQLGSLGG GNHFTEMQVD QDGRVWVMLH TGSRGFGWNI AKHFFVEGAA       240
     QLGLKSRSED HVWLDAESPL GRDYWNLHNM AANFAVANRL IIGEAVCAAL EDVFGGTASV       300
     YYEISHNLIQ KEAGKFVARK GATRAFPGGH PALKGTPWEK TGHPILIPGS METGSAILFA       360
     EPGAQKSIYS VNHGSGRRMS RGEARRVLKQ DVTDKRMAEA GILLNTRQTP LDESGPCYKN       420
     LDDVLETVEM AGLARVAYRL KPVACIKGAD                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page