(data stored in ACNUC30630 zone)

EMBL: CP000113.PE617

CP000113.PE617       Location/Qualifiers
FT   CDS             734257..735216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0635"
FT                   /product="ParA family protein"
FT                   /note="identified by similarity to SP:P37522; match to
FT                   protein family HMM PF01656"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86116"
FT                   /db_xref="GOA:Q1DEM0"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1DEM0"
FT                   /protein_id="ABF86116.1"
FT                   /translation="MEAPTYSSKQVAEMLGVSPKQIPEESRKDAYTPDDIWELRTTLDR
FT                   FPARLGHRRQLFLNFKGGTGKTSLSTSYAWRLAELGYAVLLIDLDSQGHATKCLGYEGE
FT                   DFEKTLLDVLVRKTPLAKVIQKSSLPNLDFVPSNLTMSTVDLALMPMAGREFKLRNALK
FT                   DVEAQYDVVVFDAPPSFGLLNLNALMAANDLFVPVLADFLSFHGLKLLFETVQSLEEDL
FT                   NHVLDHVFIVVNSFNATFKLAKEALEALQTHYPEFLLPTIIRQCTKFAQASSEGRPVFV
FT                   ADPSSKGANDIQAMIDNILPRLVAAAAVAQTKGTQQAG"
     MEAPTYSSKQ VAEMLGVSPK QIPEESRKDA YTPDDIWELR TTLDRFPARL GHRRQLFLNF        60
     KGGTGKTSLS TSYAWRLAEL GYAVLLIDLD SQGHATKCLG YEGEDFEKTL LDVLVRKTPL       120
     AKVIQKSSLP NLDFVPSNLT MSTVDLALMP MAGREFKLRN ALKDVEAQYD VVVFDAPPSF       180
     GLLNLNALMA ANDLFVPVLA DFLSFHGLKL LFETVQSLEE DLNHVLDHVF IVVNSFNATF       240
     KLAKEALEAL QTHYPEFLLP TIIRQCTKFA QASSEGRPVF VADPSSKGAN DIQAMIDNIL       300
     PRLVAAAAVA QTKGTQQAG                                                    319
//

If you have problems or comments...

PBIL Back to PBIL home page