(data stored in ACNUC30630 zone)

EMBL: CP000113.PE7

CP000113.PE7         Location/Qualifiers
FT   CDS             complement(9261..10496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0009"
FT                   /product="transporter, major facilitator family"
FT                   /note="identified by match to protein family HMM PF05977;
FT                   match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86434"
FT                   /db_xref="GOA:Q1DGD0"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DGD0"
FT                   /protein_id="ABF86434.1"
FT                   /translation="MRTLRLPRLSSLRAFDHPGYFAVWVGALISTIGTWMETVAMGVYV
FT                   TEATGRAEWTGGIVALTFLPAVVLSPVGGALADRFDRRAYVALGTVVQLVLAGVLTLLA
FT                   FTHRLSVPVVAVISFVHGCASTLINPAFAAMLAELVPPRDLHSAMSLNSAQFNLGRIIG
FT                   PALAALVLSMGGTSWALLINTLSFVAVLVALSQVKTLTRKVTEGGQGLWKQIAHGFTVA
FT                   RGDPEISLMLWGTFLVAGLVAPFIGLVPVFAIRVFGQGAAATSLLVTCQGAGAVTAALL
FT                   VGTLVDRWGQRKLLGIVATSIGVVSTLYWLSPTLQMAAVVIFVLGANYMMLMSGMHAYC
FT                   QSRVPRELQARMSSLYSMVLGGAYASGVWGLGALADRLGIRFVTVSASVLFIALVLTLR
FT                   LLRPQRFDGAVA"
     MRTLRLPRLS SLRAFDHPGY FAVWVGALIS TIGTWMETVA MGVYVTEATG RAEWTGGIVA        60
     LTFLPAVVLS PVGGALADRF DRRAYVALGT VVQLVLAGVL TLLAFTHRLS VPVVAVISFV       120
     HGCASTLINP AFAAMLAELV PPRDLHSAMS LNSAQFNLGR IIGPALAALV LSMGGTSWAL       180
     LINTLSFVAV LVALSQVKTL TRKVTEGGQG LWKQIAHGFT VARGDPEISL MLWGTFLVAG       240
     LVAPFIGLVP VFAIRVFGQG AAATSLLVTC QGAGAVTAAL LVGTLVDRWG QRKLLGIVAT       300
     SIGVVSTLYW LSPTLQMAAV VIFVLGANYM MLMSGMHAYC QSRVPRELQA RMSSLYSMVL       360
     GGAYASGVWG LGALADRLGI RFVTVSASVL FIALVLTLRL LRPQRFDGAV A                411
//

If you have problems or comments...

PBIL Back to PBIL home page