(data stored in ACNUC30630 zone)

EMBL: CP000113.PE77

CP000113.PE77        Location/Qualifiers
FT   CDS             89549..91279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0080"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07287"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91640"
FT                   /db_xref="InterPro:IPR010839"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG60"
FT                   /protein_id="ABF91640.1"
FT                   /translation="MLPSGELMPASPLRVGNASGFYGDRFSAVREMLEGGQLDVLTGDY
FT                   LAELTMLILGRDRMKDPSTGYAKTFLKQMEQCLALVVEKKVKVVTNAGGLNPSGLAAAL
FT                   REVAAKLGVKVRVAHVEGDDLSAQADALGLGSPLTANAYLGGWGIAACLRAGADIVVTG
FT                   RVTDASLVVGPAAAHFGWKVDDWDRLAGAMVAGHVLECGTQATGGNFSFFTELDARRPG
FT                   FPLAELYEDGSSVITKHAGSGGAVTVDTVLAQLVYEITGARYAGPDATARFDTISLASH
FT                   GKDRVRVSGVRGEPPPPTMKVCLNNLGGYRNEATFILVGLDIEEKARLVREQLEAALTR
FT                   KPKELQWMLTRTDREDAATEEQAAAFLRVVVKDADAKVVGRAFSGAAVELALGSYPGFT
FT                   MTAPPSDGAPYGVYTPAYVEAGRVEHVAVLEDGTCTAITPPGETRSLEPVEPPPLPPPV
FT                   PGGPTRRVPLGRIVAARSGDKGGTANIGVWARTDAAWRWLAHALTEEKLRELLPEAAPL
FT                   RIERHVFPNLRGLNFVVEGLLGEGVSSSTRFDPQGKALGEWLRSRHMDIPEALLREGQE
FT                   "
     MLPSGELMPA SPLRVGNASG FYGDRFSAVR EMLEGGQLDV LTGDYLAELT MLILGRDRMK        60
     DPSTGYAKTF LKQMEQCLAL VVEKKVKVVT NAGGLNPSGL AAALREVAAK LGVKVRVAHV       120
     EGDDLSAQAD ALGLGSPLTA NAYLGGWGIA ACLRAGADIV VTGRVTDASL VVGPAAAHFG       180
     WKVDDWDRLA GAMVAGHVLE CGTQATGGNF SFFTELDARR PGFPLAELYE DGSSVITKHA       240
     GSGGAVTVDT VLAQLVYEIT GARYAGPDAT ARFDTISLAS HGKDRVRVSG VRGEPPPPTM       300
     KVCLNNLGGY RNEATFILVG LDIEEKARLV REQLEAALTR KPKELQWMLT RTDREDAATE       360
     EQAAAFLRVV VKDADAKVVG RAFSGAAVEL ALGSYPGFTM TAPPSDGAPY GVYTPAYVEA       420
     GRVEHVAVLE DGTCTAITPP GETRSLEPVE PPPLPPPVPG GPTRRVPLGR IVAARSGDKG       480
     GTANIGVWAR TDAAWRWLAH ALTEEKLREL LPEAAPLRIE RHVFPNLRGL NFVVEGLLGE       540
     GVSSSTRFDP QGKALGEWLR SRHMDIPEAL LREGQE                                 576
//

If you have problems or comments...

PBIL Back to PBIL home page