(data stored in ACNUC30630 zone)

EMBL: CP000113.PE83

CP000113.PE83        Location/Qualifiers
FT   CDS             97598..98335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0086"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91490"
FT                   /db_xref="InterPro:IPR029074"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG54"
FT                   /protein_id="ABF91490.1"
FT                   /translation="MDSVLDNILFLVGQRMPRLQSSSAKPDAKLTLETAALWRQYGCGL
FT                   LLSELDDEGFRDGLEQAATLYLNLLNRRSACSEFDQYYLARSKGEPLLDALAAGNWDLA
FT                   RSIAAAMTPTWMQRMESEEDFHYFGALIALVLAQSHLGAELAAFERTLQGGGSHRFDVV
FT                   QALSKQEADAFDAGLHGMIEEQAAWVERQRRSGLFDPYRHKTEAFVFVEGAALVQLARR
FT                   LGVPTQERYRLIPSAALELQART"
     MDSVLDNILF LVGQRMPRLQ SSSAKPDAKL TLETAALWRQ YGCGLLLSEL DDEGFRDGLE        60
     QAATLYLNLL NRRSACSEFD QYYLARSKGE PLLDALAAGN WDLARSIAAA MTPTWMQRME       120
     SEEDFHYFGA LIALVLAQSH LGAELAAFER TLQGGGSHRF DVVQALSKQE ADAFDAGLHG       180
     MIEEQAAWVE RQRRSGLFDP YRHKTEAFVF VEGAALVQLA RRLGVPTQER YRLIPSAALE       240
     LQART                                                                   245
//

If you have problems or comments...

PBIL Back to PBIL home page